Human HBP, His tag
SKU: 95073031084

Human HBP, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human HBP, His tagProduct Specification Species Human Synonyms Cationic antimicrobial protein CAP37, Heparin binding protein (HBP; hHBP) Accession P20160 Amino Acid Sequence Protein sequence (P20160, Ile27 Ala251, with C 10*His) IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPAGGGGSHHHHHHHHHH

Product Specification


Species Human
Synonyms Cationic antimicrobial protein CAP37, Heparin-binding protein (HBP; hHBP)
Accession P20160
Amino Acid Sequence

Protein sequence (P20160, Ile27-Ala251, with C-10*His) IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 26 kDa Observed MW: 35-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Azurocidin also known as cationic antimicrobial protein CAP37 or heparin-binding protein (HBP) is a protein that in humans is encoded by the AZU1 gene. Azurophil granules, specialized lysosomes of the neutrophil, contain at least 10 proteins implicated in the killing of microorganisms. The protein encoded by this gene is an azurophil granule antimicrobial protein, with monocyte chemotactic and antibacterial activity. It is also an important multifunctional inflammatory mediator. In patients with fever, high plasma levels of HBP indicates that the patient is at high risk of developing sepsis with circulatory collapse.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95073031084

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 994 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Doc Watson
Carnegie, US
★★★★★ 3
Gothic Star Wars
Format: Paperback
This trade paperback collects all the issues for the Screaming Citadel story spread over several titles, including the main stay Star Wars series and the Dr Aphra book. As one might expect from a story spread over different titles with different artists and writers, the presentation varies. The art is all over the place. In the Marco Checchetto-drawn initial issue, everyone’s favorite amoral artifact hunter, Dr Aphra, is a striking space vixen. But in the following issues she’s hardly recognizable as the same character--mousier, if still menacing, in her trademark Russian tanker’s hat. To a lesser degree, the same is true for the other characters, including the main SW group. It’s understandable, but a bit disconcerting. The story centers on Dr Aphra, who, in need of a Jedi for one of her typically nefarious purposes, recruits Luke into her scheme. Unfortunately for Aphra, she’s up against a more ruthless foe in the harlequin-looking vampire-like Queen of the Screaming Citadel. Before long, the rest of the group has to show up to rescue them. It’s a gothic story, set in scary castle—not the usual Star Wars fare. There are some good points. Dr Aphra’s almost sociopathic outlook is always good for a few choice lines, the “murderous machines” Bee Tee and Triple Zero are on hand for their own gruesome commentary and some of the Queens hench-people, while not given much to do, are interestingly designed. But overall, the horror movies plotline didn’t seem much like Star Wars to me. Recommended for those who enjoy that type of story, or completists.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2018
P
Verified Purchase
PWDecker
Waukegan, US
★★★★★ 4
Luke and Doctor Aphra team up!
Format: Paperback
This is the second crossover event in the Marvel Star Wars comics. It brings the ongoing Doctor Aphra and Star Wars series together. I liked the pairing of Luke with Aphra. They play well off of each other with Luke's naive goodness and Aphra's experienced gray morality. I liked when she called him a wannabe padawan. There are some well designed characters in this comic. The residents of the Screaming Citadel have a goth bdsm vibe. Luke even gets to dress up. I liked seeing him in something different. I want to know more about Sana and Aphra's past!!! Please, Marvel, make a queer love story prequel!!! The murder droids are wonderful. Having them on the same side as the "good guys" for at least the time being led to some funny situations. The last panel intrigued me. I give this graphic novel a 4/5. I am always here for more Doctor Aphra!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2017
K
Verified Purchase
Kindle Customer
Chelsea, US
★★★★★ 5
Excellent mini series.
Format: Kindle
This is an excellent follow up to Vader Down. Luke Skywalker and friends take on a bigger threat than The Empire and Darth Vader that is connected to the Jedi. Luke and Dr. Aphra join forces to find the answers Like is seeking. Truly worth reading and entertaining.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 23, 2019
R
Verified Purchase
Ryan of the East Coast
Charlottesville, US
★★★★★ 5
Source material for Nolan's trilogy is powerful writing and art...
Format: Paperback
The Long Halloween is great, but I actually had more fun reading through Dark Victory. It's a crime mystery that consistently had me guessing through to the conclusion about who The Hangman's true identity was. What I really loved most was the evolution of the characters' personalities--from Jim Gordon to Harvey Dent to Bruce (who really is more in his iconic "Batman" persona here)--that began in Batman: Year One to Batman: The Long Halloween and into Batman: Dark Victory. It really does work like a trilogy. It's also notable to include Gotham city's underworld itself as a character of its own. Batman begins (pardon the pun) in Year One with a quest to sort of rid the city of the mafia, which is and has been the main criminal body up until this point. In The Long Halloween, the mafia begins to lose power because of the rise of the Batman's presence. During that time, some of the most insane and dangerous criminals escape Arkham Asylum and begin quietly terrorizing the city anew, spreading like a virus. Slowly, the "freaks"--as the mafia calls them--start to gain more and more power by simply being a more unorganized crime source (as opposed to organized crime). Characters like Pamela Isley, Solomon Grundy, Mr. Freeze, the Penguin, Scarecrow, the Joker, and others, establish and strengthen their grips on Gotham's criminal underworld. It's nice that these villains--these "freaks"--also aren't the main conflict in Dark Victory (or The Long Halloween or Year One, for that matter); they appear when it is effective for them to appear, slowly taking more prominence in the setting of the story as it progresses. The main conflict has to deal with the solving of the mysteries behind The Hangman killings. The Long Halloween and Dark Victory are, primarily, crime mysteries, which is what makes them interesting. What makes them great literature, however, is the creative team that is Jeph Loeb and Tim Sale. Loeb's writing is really well-crafted here: the entire arc unfolds at a consistent pace and he balances out dialogue with Batman's internal narration very smoothly. And, as I mentioned previously, personality and narrative arcs of the main characters (Gordon, Batman, and Dent) have fully matured by this point in the trilogy, leaving the supporting characters a chance to evolve and come into their own. Much of these progressions are not just depicted by the writing, however; Tim Sale (who worked previously with Loeb on The Long Halloween) elevates and perfects his artwork in this story. There's not a change in the look of the characters, so you know it's definitely his style, but you sense immediately (especially if reading Dark Victory right after finishing The Long Halloween) the new level of attention paid to composition of the drawings. Shadows and silhouettes, contrasts between setting and characters, everything adds to the mood and atmosphere of the characters and the scenes they're a part of. In terms of the print itself, the paperback is excellent. This and The Long Halloween have really nice paper, which I'll catch myself sometimes randomly sniffing in the middle of a read to enjoy the new paper smell. The ink is really crisp, the colors pop, and the design of the book itself is laid out very clearly. There aren't page numbers or a contents page, but every issue is separated by chapter pages that include gorgeous, high-contrast artwork to help distinguish which issue you're on. Additionally, the print comes with an introduction by David S. Goyer, who co-wrote the Nolan film trilogy. Overall, I can't stress enough how gorgeous this trade paperback is and how excellent and top-tier this story arc is. I really enjoyed it just as much, if not more so, then The Long Halloween. No other Batman story arc has topped my enjoyment of this particular trilogy. Highly recommended in addition to Batman: Year One and Batman: The Long Halloween.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2019
K
Verified Purchase
Kris
Massapequa, US
★★★★★ 5
I love this comic book!
Format: Paperback, Format: Paperback
I love DC comics and obviously the Batfam are some of the most well known and loved characters within the DC universe. I love the art style and story in this comic. If you are debating whether or not to purchase this comic, DO IT!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2025

recommand products