DDB1/CRBN Complex, Flag&His Tag, Human
SKU: 65522343487

DDB1/CRBN Complex, Flag&His Tag, Human

$162.00 $180.00
Save 10%
No.2 Bestseller on villaloboslawfirm.com >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL
Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.
Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65522343487

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 626 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
john wenner
Chelsea, US
★★★★★ 2
Fun but not for rough play.
Color: Orange
The ball contented our “golden” Jaxson for about 15 minutes. He then thought it was a regular ball and it’s just a little delicate for a big dog. I just wrote it off as a loss. Great idea but should be more durable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
A
Verified Purchase
Ang
Natrona Heights, US
★★★★★ 5
Long lasting charge!
Color: Orange
My 50 pound goldendoodle absolutely loves this ball. It keeps a charge for a long time. It turns off When it’s not being used and we play with it every day.!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
E
Verified Purchase
Emeraldcity
Phoenix, US
★★★★★ 5
Fun toy
Color: Orange
My standard poodle loves this toy. It holds a charge for several hours and is well made
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
C
Verified Purchase
Christine Cassara
Cuba, US
★★★★★ 5
MUST HAVE!!! Dog is obsessed!!!
Color: Aqua
100 PLUS STARS!!! We have a very VERY active pup (6 yrs old 🤦‍♀️🤦‍♀️)… he has destroyed EVERYTHING we have ever given him. So I ordered this AND the replacement shell. He has chewed the ball extensively but it is in PERFECT shape, no need for the replacement one YET.. I can not rave about this enough - he LOVES it, we love watching him with it and he won’t let it out of his site at all!! If we touch it he gets upset.. so when we charge it, we put the shell back together and give him that.. which reminds me - make sure you have that screwed TIGHT.. somehow he was able to get it apart.. but once we started tightening it he hasn’t been able to.. thinking about it?? GET IT!! You won’t be disappointed and neither will your dog!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2025
Q
Verified Purchase
Quality Questionnaire
San Leandro, US
★★★★★ 4
An expensive ball to think about
Color: Aqua
Went with the foam ball because I have hopes that my dogs teeth will sink in enough to be satisfying without having to shred it like a tennis ball. So far, so good. I chose this one because the of the outer shell replacement possibility; assurance that 30 dollars towards a ball would have an extended life option for half the price if needed. It is slightly bigger than a tennis ball and big enough for my dog to be unable to get a strong clench and crush it. He does try though and it's holding up. All of the options and modes are great. However, I wish it acted more of a bait ball. Going through all three of the modes, I can't say any have sparked a wild chase. It will bounce intermittently or once touched. The intervals are long enough to lose my dogs interests. Short intervals make the ball the easy loser every time. Better on hardwood but pathetic on carpet. It will roll but not far or very fast. The only positives from this may be the battery conservation but when he stops playing with it, it is still rolling around the room. I think it takes 20-30 minutes of inactivity for sleep mode. With this, the charge will last about a day of play. It does charge quickly. It has passed the tough chewer test with one who can chew through "tuff" toys in no time but I wish it was more of a challenge. After telling my sister i purchased one, she said she would've given me hers because her dog had lost interest. Go with your hunch and find another game to invest in if you have trepidations of this being this case. I won't deduct anymore stars because the product is as advertised. Only one deducted for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 19, 2025

recommand products

The Posies Slipmat
10.00
Collins LED Pendant in Black Oxide
249.50
Fenwick LED Chandelier in Heritage Brass
564.50
Waiting: The Van Duren Story (Original Documentary Soundtrack)
16.98
Cosmopolitan Pressure Balance Rain Shower Kit with Rough-In Valve - CHROME 29428000 Grohe
733.00